PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 437aa    MW: 48198.3 Da    PI: 5.5996
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006740genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+++++++G g+W+t +   g+ R++k+c++rw +yl
      Lus10006740 15 KGPWTPEEDQKLINYIQLHGYGNWRTLPLNAGLQRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding53.17.6e-1768112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Lus10006740  68 RGRFSFEEEEVIIQLHSILGNK-WSAIASRLP-GRTDNEIKNYWNTH 112
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-24765IPR009057Homeodomain-like
PROSITE profilePS51294181062IPR017930Myb domain
SuperFamilySSF466893.41E-3112109IPR009057Homeodomain-like
SMARTSM007171.4E-121464IPR001005SANT/Myb domain
PfamPF002491.4E-151562IPR001005SANT/Myb domain
CDDcd001671.38E-111762No hitNo description
PROSITE profilePS5129425.26763117IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.4E-2666117IPR009057Homeodomain-like
SMARTSM007172.7E-1667115IPR001005SANT/Myb domain
PfamPF002497.1E-1568112IPR001005SANT/Myb domain
CDDcd001675.10E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MGRSPLSCEK NGLKKGPWTP EEDQKLINYI QLHGYGNWRT LPLNAGLQRC GKSCRLRWTN  60
YLRPDIKRGR FSFEEEEVII QLHSILGNKW SAIASRLPGR TDNEIKNYWN THIRKRLLRM  120
GIDPVTHSPR LDLLDLSAIL GSSFSSSSQP NFSRLLGLVN PEILHLATSL VSSETELQNQ  180
TQTQTQTGTF YDPPNPQYQP MVNPEFQDMT TTTMATTTTI PDEPFVEVGP SDWQRSYTLE  240
SYDHLNDYCY GTSSFDDRQT AGNTITDLST ENCFGFPPAA ASGFSTPSSS PTSLNSNSTL  300
NNVNAGSCTE DERDSYCSNM LRFEMPPSIL DLYTTLVSRV KPCVSSGSPV RACPDQHGHY  360
RPVASPRDLL DAFGGDLTSG CCGDVKLVIY RLVLCLSIHL VAAGGVVTEA HIVELVAPII  420
SEVLAFLIAY PLSPGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744481e-109JX174448.1 Linum usitatissimum clone LuBAC395P20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096186.11e-119PREDICTED: protein ODORANT1-like
TrEMBLA0A067JDN51e-118A0A067JDN5_JATCU; MYB family protein
STRINGGLYMA15G07230.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-91MYB-like 102